Recombinant D. melanogaster Protein wingless(wg)

Drosophila melanogaster

wg

wg; CG4889; Protein wingless; Protein Wnt-1; Protein int-1; dInt-1; dWnt-1

18-468

Secreted. Cell junction, synapse. Membrane; Lipid-anchor. Secreted, extracellular space, extracellular matrix.

Wnt family

Binds as a ligand to a family of frizzled seven-transmembrane receptors and acts through a cascade of genes on the nucleus. Segment polarity protein. May be a growth factor. Acts on neighboring cells to regulate at least one gene, the homeobox segmentation gene engrailed. Wg signal represses arm phosphorylation. Wg signaling operates by inactivating the sgg repression of engrailed autoactivation. Wg and Wnt2 have a role in the developing trachea and together are responsible for all dorsal trunk formation. Wg also acts in the developing epidermis. Acts as a morphogen, and diffuses long distances despite its lipidation. Lipophorin is required for diffusion, probably by acting as vehicle for its movement, explaining how it can spread over long distances despite its lipidation. In non-neuronal cells, wls directs wg secretion via clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps26 and Vps35) to sustain a wls traffic loop encompassing the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi. In neuronal cells (the larval motorneuron NMJ), wg signal moves across the synapse through the release of wls-containing exosome-like vesicles.

KEGG: Dmel_CG4889; STRING: 7227.FBpp0079060; UniGene: Dm.6628

Recombinant Protein

Yeast; E. coli; Baculovirus; Mammalian cell

GSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPG VLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAA VTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSR EFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVI GDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERM LNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNP EHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEV VVVERCACTFHWCCEVKCKLCRTKKVIYTCL

Full Length of Mature Protein

>85% (SDS-PAGE)

The following tags are available. N-terminal His-tagged Tag-Free

Lyophilized powder

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.

Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.

The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.

Repeated freezing and thawing are not recommended.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.