Recombinant D. melanogaster Partner of bursicon(pburs)
Products
Online Inquiry
Drosophila melanogaster
Pburs
Pburs; burs-beta; CG15284; Partner of bursicon; Bursicon subunit beta
21-141aa
Secreted.
Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
KEGG: Dmel_CG15284; STRING: 7227.FBpp0080207; UniGene: Dm.26812
Recombinant Protein
E. coli
LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Full Length of Mature Protein
Others
>85% (SDS-PAGE)
N-terminal GST-tagged
Liquid or Lyophilized powder
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.
Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.
The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.
Repeated freezing and thawing are not recommended.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.
For research use only. Not intended for any clinical use.