Recombinant D. melanogaster Transcription initiation factor TFIID subunit 11(Taf11)

Drosophila melanogaster

Taf11

Taf11; TAF30-BETA; CG4079; Transcription initiation factor TFIID subunit 11; TAFII30 beta; Transcription initiation factor TFIID 28 kDa subunit beta; p28-beta

1-196

Nucleus.

TAF11 family

TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors.

KEGG: Dmel_CG4079; STRING: 7227.FBpp0079514; UniGene: Dm.19807

Recombinant Protein

Yeast; E. coli; Baculovirus; Mammalian cell

MDEILFPTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGKDADGDNDNKN TDGDGDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRL MQTITGCSVSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTK DRMPIGRYQQPYFRLN

Full Length Protein

>85% (SDS-PAGE)

The following tags are available. N-terminal His-tagged Tag-Free

Lyophilized powder

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.

Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.

The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.

Repeated freezing and thawing are not recommended.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.