Recombinant D. melanogaster Transcription initiation factor TFIID subunit 11(Taf11)
- Catalog Number: CDRPO-3110893
- Size: 20 μg; 100 μg; 1000 μg
Target Information
| Species | Drosophila melanogaster |
| Target Names | Taf11 |
| Alternative Names | Taf11; TAF30-BETA; CG4079; Transcription initiation factor TFIID subunit 11; TAFII30 beta; Transcription initiation factor TFIID 28 kDa subunit beta; p28-beta |
| Expression Region | 1-196 |
| Subcellular Location | Nucleus. |
| Protein Families | TAF11 family |
| Function | TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. |
| Database Info | KEGG: Dmel_CG4079; STRING: 7227.FBpp0079514; UniGene: Dm.19807 |
Product Details
| Product Type | Recombinant Protein |
| Source | Yeast; E. coli; Baculovirus; Mammalian cell |
| Target Protein Sequence | MDEILFPTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGKDADGDNDNKN TDGDGDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRL MQTITGCSVSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTK DRMPIGRYQQPYFRLN |
| Protein Length | Full Length Protein |
| Purity | >85% (SDS-PAGE) |
| Tag Info | The following tags are available. N-terminal His-tagged Tag-Free |
| Form | Lyophilized powder |
| Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Lead Time | Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times. |
Storage & Handling
| Storage Condition | Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use. |
| Shelf Life | The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C. |
| Handling | Repeated freezing and thawing are not recommended. |
| Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week. |
For research use only. Not intended for any clinical use.