Recombinant D. melanogaster Thioredoxin-2(Trx-2)

Drosophila melanogaster

Trx-2

Trx-2; CG31884; Thioredoxin-2; DmTrx-2

1-114aa

Thioredoxin family

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. As a reducing substrate of peroxiredoxin 1, thioredoxin 2 is preferred over thioredoxin 1.

STRING: 7227.FBpp0079436; UniGene: Dm.2664

Recombinant Protein

E. coli

MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Full Length Protein

Metabolism

>85% (SDS-PAGE)

N-terminal 6xHis-SUMO-tagged

Liquid or Lyophilized powder

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.

Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.

The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.

Repeated freezing and thawing are not recommended.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.