Anti-D. melanogaster SNRPD2 Polyclonal Antibody
- Catalog Number: CDDMAB-3120973
- Size: 100 μL; 50 μL; More Options
Target Information
| Target Names | SNRPD2 |
| Function | The protein encoded by the SNRPD2 gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq) |
Product Details
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Conjugate | Non-conjugated |
| Purification Method | Immunogen affinity purified |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE. |
| Form | Liquid |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Availability | Made-to-order |
Usage
| Applications | WB, ICC/IF, IHC, IHC-P |
| Species Reactivity | Drosophila melanogaster |
Storage & Handling
| Storage Temp. | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
| Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.