Anti-D. melanogaster Segmentation protein even-skipped Polyclonal Antibody
Online
Inquiry
- Catalog Number: CDDMAB-3121155
- Size: 100 μL; 50 μL; More Options
Target Information
| Target Names | eve |
| Gene ID |
Product Details
| Host | Rabbit |
| Clonality | Polyclonal |
| Conjugate | Non-conjugated |
| Purification Method | Affinity purified |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Drosophila melanogaster (NP_523670). Peptide sequence MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS. |
| Form | Liquid |
| Buffer | PBS buffer, 2% sucrose. |
| Availability | Made-to-order |
Usage
| Applications | WB |
| Species Reactivity | Drosophila melanogaster |
Storage & Handling
| Storage Temp. | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
| Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.